PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00299-snap-gene-0.44-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 376aa    MW: 42114.4 Da    PI: 5.4901
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00299-snap-gene-0.44-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-181461148
                                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                               rg WT+eEd +++ +v ++G+g+W++++++ g++R++k+c++rw +yl
  maker-scaffold00299-snap-gene-0.44-mRNA-1 14 RGLWTEEEDAKILAYVSKHGTGNWTAVPKKAGLKRCGKSCRLRWTNYL 61
                                               788*******************************************97 PP

2Myb_DNA-binding41.23.8e-1370118446
                                                S-HHHHHHHHHHHHHTTTT.......-HHHHHHHHTTTS-HHHHHHHHHH CS
                            Myb_DNA-binding   4 WTteEdellvdavkqlGgg.......tWktIartmgkgRtlkqcksrwqk 46 
                                                +T++E+e +v++++  G++       +W+ Ia+ ++ gRt++++k++w++
  maker-scaffold00299-snap-gene-0.44-mRNA-1  70 FTPQEEEMIVRLHAAIGSRwatykllSWSIIAQQLP-GRTDNDVKNYWNT 118
                                                9***********************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.323965IPR017930Myb domain
SuperFamilySSF466894.77E-2711116IPR009057Homeodomain-like
SMARTSM007171.6E-151363IPR001005SANT/Myb domain
PfamPF002493.3E-171461IPR001005SANT/Myb domain
CDDcd001671.88E-121761No hitNo description
Gene3DG3DSA:1.10.10.605.7E-2165124IPR009057Homeodomain-like
SMARTSM007174.5E-1066122IPR001005SANT/Myb domain
PROSITE profilePS5129412.34166124IPR017930Myb domain
PfamPF002491.3E-1170118IPR001005SANT/Myb domain
CDDcd001675.48E-970120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MVRSPCCDKL NLKRGLWTEE EDAKILAYVS KHGTGNWTAV PKKAGLKRCG KSCRLRWTNY  60
LRPDLKHDGF TPQEEEMIVR LHAAIGSRWA TYKLLSWSII AQQLPGRTDN DVKNYWNTKL  120
RKKLSEMGID PVTHKPFSQI LADYGNIGGF RKPGTRVGPL NKDLKSAIML KSEPYPAAPQ  180
GFPNFNSQLM TATISPQKKP IQDTLFNNNH TDNYPSDLLA ELQAIKLVTE ASNCSNNETI  240
PPPAFAEASL SSSSMSYSPT CSTTAAQEKS SLDFSWHDFL LDDAFLPADP QEQETTAEYS  300
SKEFASQKQK GILQISDTDN EAAIQESNTK AKAIECAVIS NDFEASSSSD FAFVEAMLYQ  360
EYEMLLDFPN LEPFYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26111244108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042628.11e-147PREDICTED: transcription repressor MYB6-like
TrEMBLM5WT281e-146M5WT28_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s07450.11e-141(Populus trichocarpa)
STRINGPOPTR_0015s07900.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-73MYB family protein